DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstO2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:243 Identity:53/243 - (21%)
Similarity:93/243 - (38%) Gaps:75/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FRLSNMPFEDCV---VALRNGEH------LTE--DFKKEINRFQRVPCIHDNGYK----LAESVA 112
            |.::..||...|   :|.::.||      |.|  ::.|:.:...:||.:...|.|    |.||:.
  Fly    26 FSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTGVKDQPTLVESLI 90

  Fly   113 ILRYLSAKGKIPE-HLYP----KYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLT--GRT 170
            |..||..  :.|: .|:|    :..:|:..::.|..       :..|:|       |:||  ...
  Fly    91 IAEYLDQ--QYPQTRLFPTDPLQKALDKILIERFAP-------VVSAIY-------PVLTCNPNA 139

  Fly   171 PSEAKIETFRMQMERNLDVVE-EVWLEGKDFLTGSSLTVADI--------FAACEIEQTRMADYD 226
            |.:| |..|    |..|||.| |:...|..:..|..:.:.|.        |.:.:|...:..:.|
  Fly   140 PKDA-IPNF----ENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELD 199

  Fly   227 VRIKYPKIRAW----------------------LKRVRQSCNPYYDVA 252
            .: ::.|:..|                      .::.:...||.||:|
  Fly   200 TK-RFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYDIA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 20/72 (28%)
GstA 47..243 CDD:223698 48/232 (21%)
GST_C_Theta 135..259 CDD:198292 29/151 (19%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 19/69 (28%)
GstA 25..215 CDD:223698 48/210 (23%)
GST_C_Omega 110..235 CDD:198293 25/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.