DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006538109.1 Gene:Tbc1d2 / 381605 MGIID:2652885 Length:923 Species:Mus musculus


Alignment Length:305 Identity:59/305 - (19%)
Similarity:108/305 - (35%) Gaps:85/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASLLGLSNDEDQLQVAFDEV-----LKRRVPSRQPTNLRMS--APIR---------YYYDLMSQP 55
            ::.|..:.|.|:|::...:|     |.:||.:.:....|::  |.:|         :...||.:.
Mouse   351 SAYLAATEDRDRLELVRHKVRQIAELNQRVEALEQGRERLAHEAGLREQQVQALQQHVQLLMDKN 415

  Fly    56 SRALFIIFRLSNMPFEDCV--VALRNG---------EHLTEDFK--KEINRF--QRVPCIHDNGY 105
            .....:|.:|:....||..  ....||         |||.:|.:  :..|||  ..:..:.....
Mouse   416 HAKQQVICKLTQKLTEDLAQPADATNGDFLSQQERMEHLKDDMEAYRTQNRFLNSEIHQVTKIWR 480

  Fly   106 KLAESVAIL----RYLSAK-----------------------GKIPEHLYPKYFVDQSRVDEFLE 143
            |:||....|    .||.|:                       |..||.|       |..:.|.|:
Mouse   481 KVAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEAAGAEAGDFPELL-------QQLIQEALQ 538

  Fly   144 WQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSL-- 206
            |:        |....:|.|.|:..........:..:.|:..:.|..::.:.:.....|...::  
Mouse   539 WE--------AGEADSVGLSPVSEYDDYGFLTVPDYEMEDLKLLAKIQALEVRSHHLLAHEAVER 595

  Fly   207 -------TVADIFAACEIEQTRMADYDVRIKYPKIRAWL--KRVR 242
                   |:.::..:.|::|...|... |...|::..||  :|||
Mouse   596 PLRDRWATLTELTPSAELKQLLRAGVP-REHRPRVWRWLVHRRVR 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 23/126 (18%)
GstA 47..243 CDD:223698 48/249 (19%)
GST_C_Theta 135..259 CDD:198292 22/119 (18%)
Tbc1d2XP_006538109.1 PH_TBC1D2A 45..146 CDD:269966
PRK14951 <192..404 CDD:237865 11/52 (21%)
COG4913 <300..>565 CDD:227250 45/228 (20%)
TBC 620..832 CDD:214540 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.