DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Gr59f

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:223 Identity:37/223 - (16%)
Similarity:66/223 - (29%) Gaps:106/223 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ESVAILRYLSAKGKIPEHLY------------------PK-------------YFVDQSRVDEFL 142
            :.|::.|||:|   |...:|                  ||             |.:|.:|...|:
  Fly    92 QRVSLDRYLNA---IESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFI 153

  Fly   143 E------------------WQH--------MSLR----------LTCAMYFRTV----WLEPLLT 167
            .                  |.|        :|:.          ::.|.|:..:    |.:..||
  Fly   154 RLQLFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLT 218

  Fly   168 G---------RTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAAC-------- 215
            .         .:|..::::..||.....:|..:.|   .:.|    ..::..:|..|        
  Fly   219 EGLERELTHLHSPRISEVQKIRMHHANLIDFTKAV---NRTF----QYSILLLFVGCFLNFNLVL 276

  Fly   216 -----EIEQTRMADYDVRIKYPKIRAWL 238
                 .||...|||:   .|:..:..||
  Fly   277 FLVYQGIENPSMADF---TKWVCMLLWL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 5/11 (45%)
GstA 47..243 CDD:223698 37/223 (17%)
GST_C_Theta 135..259 CDD:198292 26/166 (16%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 37/223 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.