DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and TBC1D10C

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001356427.1 Gene:TBC1D10C / 374403 HGNCID:24702 Length:454 Species:Homo sapiens


Alignment Length:68 Identity:16/68 - (23%)
Similarity:27/68 - (39%) Gaps:14/68 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 FLTGSSL------TVADIFAACE---IEQTRMADYDVRIKYPKIRAWLKR-----VRQSCNPYYD 250
            |:.|||.      ..||:....|   :|.|...:..:..:|.|::...::     :|..|.|...
Human    42 FIGGSSAEPGPGHPPADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLC 106

  Fly   251 VAH 253
            .||
Human   107 GAH 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348
GstA 47..243 CDD:223698 11/56 (20%)
GST_C_Theta 135..259 CDD:198292 16/68 (24%)
TBC1D10CNP_001356427.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 4/15 (27%)
TBC 89..302 CDD:214540 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..454
Interaction with calcineurin 414..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.