DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstE8

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:207 Identity:64/207 - (30%)
Similarity:97/207 - (46%) Gaps:24/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYL 117
            |.|.||..:......:|:|...:.....|.|:.:|.:: |....||.:.|:|:.:.:|.||..||
  Fly    12 SPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRK-NPQHTVPTLEDDGHFIWDSHAISAYL 75

  Fly   118 SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRT--PSE---AKIE 177
            .:|....:.||||..:.::.||:.|   |....:......|.:......||:|  |.|   |.||
  Fly    76 VSKYGQSDTLYPKDLLQRAVVDQRL---HFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIE 137

  Fly   178 TFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDV--RIKYPKIRAWLKR 240
            .:        |.| |.:|.|.||:.|..||:||......|  |.:|.:.|  .:||..|.||:||
  Fly   138 IY--------DFV-ETFLTGHDFIAGDQLTIADFSLITSI--TALAVFVVIDTVKYANITAWIKR 191

  Fly   241 VRQSCNPYYDVA 252
            :.:.  |||:.|
  Fly   192 IEEL--PYYEEA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 19/67 (28%)
GstA 47..243 CDD:223698 60/196 (31%)
GST_C_Theta 135..259 CDD:198292 40/125 (32%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 60/200 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/65 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.