DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstE7

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:207 Identity:63/207 - (30%)
Similarity:104/207 - (50%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYL 117
            |.|.||:.:......:|:|...|..|..|:.:|:|.|: |....||.:.|:|:.:.:|.||:.||
  Fly    12 SPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKK-NPQHTVPTLEDDGHYIWDSHAIIAYL 75

  Fly   118 SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGR---TPSE---AKI 176
            .:|....:.||||..:.::.||:.|   |....:..|...|:: .:||..|:   .|.|   |.|
  Fly    76 VSKYGKTDSLYPKDLLQRAVVDQRL---HFESGVIFANALRSI-TKPLFAGKQTMIPKERYDAII 136

  Fly   177 ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLKRV 241
            |.:        |.:|: :|.|.|::.|:.||:||......:....:.......|||:|.||.||:
  Fly   137 EVY--------DFLEK-FLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRL 192

  Fly   242 RQSCNPYYDVAH 253
            ::.  |||:.|:
  Fly   193 QKL--PYYEEAN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/67 (33%)
GstA 47..243 CDD:223698 59/195 (30%)
GST_C_Theta 135..259 CDD:198292 36/125 (29%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 59/199 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/65 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.