DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstE5

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:216 Identity:62/216 - (28%)
Similarity:103/216 - (47%) Gaps:40/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYL 117
            |.|.||:.:......:|:|...|.:...|.|:|::.|: |....||.:.|:|..:.:|.||:.||
  Fly    12 SPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKK-NPEHTVPTLEDDGNYIWDSHAIIAYL 75

  Fly   118 SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLL---TGRTPSE---AKI 176
            .:|....:.|||:..:.::.||:.|   |....:..|...:.: .:||.   ..|.|.|   |.:
  Fly    76 VSKYADSDALYPRDLLQRAVVDQRL---HFETGVVFANGIKAI-TKPLFFNGLNRIPKERYDAIV 136

  Fly   177 ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVAD---------IFAACEIEQTRMADYDVRIKYP 232
            |.:        |.| |.:|.|.|::.|..||:||         :.|..||:         |:|||
  Fly   137 EIY--------DFV-ETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEID---------RLKYP 183

  Fly   233 KIRAWLKRVRQSCNPYYDVAH 253
            :|..|::|:.:.  |||:.|:
  Fly   184 RIIEWVRRLEKL--PYYEEAN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/67 (31%)
GstA 47..243 CDD:223698 58/204 (28%)
GST_C_Theta 135..259 CDD:198292 37/134 (28%)
GstE5NP_611327.1 GstA 4..196 CDD:223698 58/208 (28%)
Thioredoxin_like 4..77 CDD:294274 21/65 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/136 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.