DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstE2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:224 Identity:68/224 - (30%)
Similarity:105/224 - (46%) Gaps:39/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGY 105
            ||..:..|...:|.|.||..:..|..|:.:|...:.|..|:|..:.|.|: |....||.:.|||.
  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKK-NPQHTVPLLEDNGA 64

  Fly   106 KLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQ----HMSLRLTCAMYF-RTVWLEPL 165
            .:.:|.||:.||..|....:.|||:..|.:::||:.|.:.    .||||.....|| |.|.|.| 
  Fly    65 LIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVP- 128

  Fly   166 LTGRTPSEAKIETFRMQMERNLDVVEEVW------LEGKDFLTGSSLTVADIFAACEIEQTRMA- 223
                              :..:|.:::.:      |....:||||.||:||:  .|....:.:| 
  Fly   129 ------------------KEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADL--CCGATASSLAA 173

  Fly   224 --DYDVRIKYPKIRAWLKRVRQSCNPYYD 250
              |.| .:||||:.||.:|:  |..|:|:
  Fly   174 VLDLD-ELKYPKVAAWFERL--SKLPHYE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/75 (32%)
GstA 47..243 CDD:223698 63/209 (30%)
GST_C_Theta 135..259 CDD:198292 37/130 (28%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 64/215 (30%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 37/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.