DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and CG8155

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611029.3 Gene:CG8155 / 36698 FlyBaseID:FBgn0034009 Length:1098 Species:Drosophila melanogaster


Alignment Length:162 Identity:44/162 - (27%)
Similarity:62/162 - (38%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVSF------LAS-LLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPIRY------YYD--- 50
            |||:      :|| ||...|||.|..:.|..::.|...:.....:.|:....:      :||   
  Fly   334 SVSYCQGMSDIASPLLVTMNDEAQAYICFCAIMSRMRGNFMLDGIAMTQKFAHLTEALSFYDPEF 398

  Fly    51 ---LMSQPSRALFIIFR------LSNMPFEDCVVALRNGE------HLTEDFKKEINRFQR--VP 98
               |.||.:..|...:|      ....||||   |||..|      ....|.:||:..|::  ||
  Fly   399 WEYLKSQQADDLLFCYRWLLLELKREFPFED---ALRMLEVQWSSLRYRCDGEKELALFEKEFVP 460

  Fly    99 CIHDNGYKLAESVAILRYLSAKGKIPEHLYPK 130
             |.|.....:.|.....| ||....|.:|..|
  Fly   461 -ITDASVPNSASTFSSSY-SATPTSPSYLLTK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 27/101 (27%)
GstA 47..243 CDD:223698 30/110 (27%)
GST_C_Theta 135..259 CDD:198292
CG8155NP_611029.3 TBC 225..439 CDD:214540 29/107 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.