DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d10b

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001102391.1 Gene:Tbc1d10b / 365372 RGDID:1309191 Length:795 Species:Rattus norvegicus


Alignment Length:92 Identity:17/92 - (18%)
Similarity:37/92 - (40%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YDLMSQ----PSRAL---FIIFRLSNMPFEDCVVALRNGEHLTE--DFKKEI-----NRFQRVPC 99
            |:.|.|    |.:.:   |::..::.:|..:.::...|...|.:  :.:.|:     .|......
  Rat   560 YETMEQLRNLPQQCMQEDFLVHEVTTLPVTEALIERENAAQLKKWRETRGELQYRPSRRLHGSRA 624

  Fly   100 IHDNGYK----LAESVAILRYLSAKGK 122
            ||:...:    |..|.::|...|.|.:
  Rat   625 IHEERRRQQPPLGPSSSLLSLPSLKSR 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 16/89 (18%)
GstA 47..243 CDD:223698 17/92 (18%)
GST_C_Theta 135..259 CDD:198292
Tbc1d10bNP_001102391.1 TBC 340..545 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.