DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstE14

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:210 Identity:52/210 - (24%)
Similarity:89/210 - (42%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVA 112
            |||..|.|.|:..::.:|.::..|...|.|..||...:|| ..:|....||.:......|.:|.|
  Fly     9 YYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDF-LALNPQHSVPTLVHGDLVLTDSHA 72

  Fly   113 ILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIE 177
            ||.:|:.|......|:|:...::.:|...|.::       |:..|           |..|:....
  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFE-------CSFLF-----------RRDSDFMSA 119

  Fly   178 TFRM--------QMERNLD---VVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRI-- 229
            |.|.        ..||.|.   ::.|.:||..||:.|..||:||:...     |.::..::..  
  Fly   120 TVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIV-----TTLSTVNLMFPL 179

  Fly   230 -KYPKIRAWLKRVRQ 243
             ::|::|.|...::|
  Fly   180 SQFPRLRRWFTAMQQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 23/72 (32%)
GstA 47..243 CDD:223698 51/208 (25%)
GST_C_Theta 135..259 CDD:198292 26/123 (21%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 52/210 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 23/70 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/124 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.