powered by:
Protein Alignment GstT3 and Sgsm3
DIOPT Version :9
Sequence 1: | NP_001162808.1 |
Gene: | GstT3 / 33047 |
FlyBaseID: | FBgn0031117 |
Length: | 268 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_942082.2 |
Gene: | Sgsm3 / 362963 |
RGDID: | 735113 |
Length: | 763 |
Species: | Rattus norvegicus |
Alignment Length: | 43 |
Identity: | 12/43 - (27%) |
Similarity: | 21/43 - (48%) |
Gaps: | 2/43 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 IFAACEIEQTRMADYDVRIKYPKIRAWLKRVRQSCNPYYDVAH 253
:::...:.:|...|.|.::..|: ..|.|..||.|..:|.||
Rat 620 VYSRLVLCKTYRLDEDGKVLTPE--ELLYRAVQSVNVTHDAAH 660
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5210 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.