powered by:
Protein Alignment GstT3 and Tbc1d10c
DIOPT Version :9
Sequence 1: | NP_001162808.1 |
Gene: | GstT3 / 33047 |
FlyBaseID: | FBgn0031117 |
Length: | 268 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001075449.1 |
Gene: | Tbc1d10c / 361697 |
RGDID: | 1311490 |
Length: | 446 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 15/68 - (22%) |
Similarity: | 28/68 - (41%) |
Gaps: | 14/68 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 200 FLTGSSLTV------ADIFAACE---IEQTRMADYDVRIKYPKIRAWLKR-----VRQSCNPYYD 250
|:.|:|..: ||:....| :|.|...:..:..:|.|::...:: :|..|.|...
Rat 42 FIGGNSAELGLGQPPADLIRQREMKWVEMTLHWEKTMSRRYKKVKIQCRKGIPSALRARCWPLLC 106
Fly 251 VAH 253
.||
Rat 107 GAH 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5210 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.