DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d10a

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001015022.1 Gene:Tbc1d10a / 360968 RGDID:1311641 Length:505 Species:Rattus norvegicus


Alignment Length:129 Identity:23/129 - (17%)
Similarity:42/129 - (32%) Gaps:47/129 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 DEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTG 203
            |:::..:|..:||.|..     .:.|.|.||                       .|    .:|:|
  Rat    94 DKWMAKKHKKIRLRCQK-----GIPPSLRGR-----------------------AW----QYLSG 126

  Fly   204 SSLTVADIFAACEIEQT--RMADYDVRIKYPKIRAWLKRVRQSCNPYYDVAHEFVYKISGTGPQ 265
            ..:         :::|.  :..:.|:....||   ||..:.:..:..:.. ||......|.|.|
  Rat   127 GKV---------KLQQNPGKFDELDMSPGDPK---WLDVIERDLHRQFPF-HEMFVSRGGHGQQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348
GstA 47..243 CDD:223698 18/105 (17%)
GST_C_Theta 135..259 CDD:198292 20/121 (17%)
Tbc1d10aNP_001015022.1 TBC 110..313 CDD:214540 18/113 (16%)
VCX_VCY 404..>501 CDD:291884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.