DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstE13

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:208 Identity:52/208 - (25%)
Similarity:97/208 - (46%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHD-NG 104
            ||.| ..||.|.|.|:||..::.:|..:..|...|.....|||:|:|.| :|...::|...| :|
  Fly     1 MSKP-TLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVK-LNPQHQIPVFVDSDG 63

  Fly   105 YKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQH-MSLRLTCAMYFRTVWLEPLLTG 168
            ....:|.||:.:|.||....:.|||:....::.:|..:.::: :..::...:..|.::       
  Fly    64 EVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY------- 121

  Fly   169 RTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDV-----R 228
              ..|.:.....:.:..|.....|.:|:...|:.|:.|:|||:..     .|.:...|:     |
  Fly   122 --GGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSI-----HTTLVTLDLLIPVER 179

  Fly   229 IKYPKIRAWLKRV 241
            .|||:.:.|::|:
  Fly   180 EKYPQTKQWMERM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 25/76 (33%)
GstA 47..243 CDD:223698 49/202 (24%)
GST_C_Theta 135..259 CDD:198292 20/113 (18%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 25/75 (33%)
GST_C_Delta_Epsilon 92..211 CDD:198287 20/115 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.