DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and CG1695

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster


Alignment Length:174 Identity:40/174 - (22%)
Similarity:60/174 - (34%) Gaps:55/174 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VAILRYLSA-----KGKIPEHLYPKYFVDQSRVDEFLEWQHM--------SLRLTCAMYF----- 157
            :|..|:||.     .|.:...:.|....|:..:... :|..|        .|.|...:||     
  Fly   565 LAYCRHLSTVRTHLSGLVNGRIMPDLAADEEGLTRG-KWLAMHEDGVVTGDLELYRLVYFGGVEP 628

  Fly   158 ---RTVWLEPLLTGR-----TPSEAK--IETFRMQMERNLD---VVEEVWLEGKDFLTGSSLTVA 209
               :.||  |.|.|.     ||.|.|  .||.:...|..:.   .||.:..:.:...|  :|.||
  Fly   629 ELRKEVW--PYLLGHYDFGSTPEERKKQDETCKHYYETTMSEWLAVEAIVRQREKEKT--ALAVA 689

  Fly   210 DIFAACEIEQTRMADYDVRIKYPKIRAWLKRVRQSCNPYYDVAH 253
            .:.|    ||.|:|               .....|.||:..:|:
  Fly   690 KLSA----EQARLA---------------ANATSSSNPHQKLAN 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 4/14 (29%)
GstA 47..243 CDD:223698 36/162 (22%)
GST_C_Theta 135..259 CDD:198292 33/145 (23%)
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552 20/85 (24%)
TBC 947..1124 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.