DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and clic1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:251 Identity:53/251 - (21%)
Similarity:80/251 - (31%) Gaps:95/251 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAK 120
            |:.||::..|..:.|....|          |.|::                    ..||:.|:..
Zfish    27 SQRLFMVLWLKGVTFNVTTV----------DMKRK--------------------PEILKDLAPG 61

  Fly   121 GKIPEHLY-PKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPS------------ 172
            .:.|..|| .:...|.::::||||      ...|...:      |.|....|.            
Zfish    62 AQPPFLLYGTEVKTDTNKIEEFLE------ETLCPPKY------PRLAACNPESNTAGLDVFSKF 114

  Fly   173 EAKIETFRMQMERNL--------------------DVVEE-----VWLEGKDFLTGSSLTVADIF 212
            .|.|:....||..||                    |.::|     |....:.||.|..||:||  
Zfish   115 SAYIKNSNPQMNDNLEKGLLKALKKLDDYLSSPLPDEIDENSADDVISSTRSFLDGQELTLAD-- 177

  Fly   213 AACEIEQTRMADYDVRIKYPKIRAW-LKRVRQSCNPYYDVAH---EFVYKISGTGP 264
              |.:....   :.|::...|.|.: :.|...|...|.|.|:   ||    |.|.|
Zfish   178 --CNLLPKL---HIVKVVCLKFRGFSIPRSLTSLWRYLDAAYAREEF----SSTCP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 11/64 (17%)
GstA 47..243 CDD:223698 44/225 (20%)
GST_C_Theta 135..259 CDD:198292 35/164 (21%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 20/101 (20%)
O-ClC 6..241 CDD:129941 53/251 (21%)
GST_C_CLIC1 100..238 CDD:198333 31/136 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.