DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and tbc

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster


Alignment Length:161 Identity:28/161 - (17%)
Similarity:48/161 - (29%) Gaps:73/161 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 QSRVDEFLEWQHMSLRLTCAMYFRTV-------W-------------LEPLLTGRTPSEAKIETF 179
            |.:..:.|:.|..|:.:.|:...|.:       |             |..|:.||...|.|.:..
  Fly   523 QQQQQQLLQAQSTSIEMVCSTMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVHGRITPEMKADEE 587

  Fly   180 RMQMER----NLDVV---------------------EEVWLEGKDFLTGSSLTVADIFAACEIEQ 219
            .:..||    |::.|                     :|||    .:|.|.       :|.....:
  Fly   588 GLTKERWQLLNVNGVLENATEFYRLVYFGGVQPELRQEVW----PYLLGH-------YAFGSTTE 641

  Fly   220 TRMADYDVRIKYPKIRAWLKRVRQSCNPYYD 250
            .|                 |:..::|..||:
  Fly   642 DR-----------------KKQDETCKHYYE 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348
GstA 47..243 CDD:223698 25/152 (16%)
GST_C_Theta 135..259 CDD:198292 28/161 (17%)
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.