DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d2b

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006243590.1 Gene:Tbc1d2b / 315880 RGDID:1307436 Length:963 Species:Rattus norvegicus


Alignment Length:110 Identity:25/110 - (22%)
Similarity:46/110 - (41%) Gaps:24/110 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 HLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQH 146
            ||..:|  :|..|:.|| ..|...||   ||.:|.|..|        ..|..:...|...::|::
  Rat   589 HLVSEF--DIYGFRTVP-DDDEEEKL---VAKVRALDLK--------TLYLTENQEVSTGVKWEN 639

  Fly   147 -----MSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERN 186
                 |:..:.|:..     |:.|:....|.|.:.:.::..::|:
  Rat   640 YFASTMNREMVCSPE-----LKNLIRAGIPHEHRSKVWKWCVDRH 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 14/38 (37%)
GstA 47..243 CDD:223698 25/110 (23%)
GST_C_Theta 135..259 CDD:198292 9/57 (16%)
Tbc1d2bXP_006243590.1 PH_TBC1D2A 36..144 CDD:269966
PH 38..136 CDD:278594
HIP1_clath_bdg <339..>376 CDD:293123
DUF1664 <346..436 CDD:285172
RabGAP-TBC 708..876 CDD:278964
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.