DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006238118.1 Gene:Tbc1d2 / 313234 RGDID:1306860 Length:924 Species:Rattus norvegicus


Alignment Length:324 Identity:65/324 - (20%)
Similarity:107/324 - (33%) Gaps:120/324 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASLLGLSNDEDQLQVAFDEV-----LKRRVPSRQPTNLRM--SAPIR---------YYYDLMSQP 55
            ::.|..:.|.|:|::...:|     |.:||.:.:....|:  .|.:|         :...||.:.
  Rat   349 SAYLAATEDRDRLELVRHKVRQIAELNQRVEALEQDRERLVHEAGLREQQVQALQQHVQLLMDKN 413

  Fly    56 SRALFIIFRLSNMPFEDCV----VALRNG---------EHLTEDFK--KEINRF--QRVPCIHDN 103
            .....:|.:||....||..    ....||         |||.:|.:  :..|||  ..:..:...
  Rat   414 QAKQQVICKLSQKLTEDLAQPQPADATNGDFLSQQERLEHLKDDMEAYRTQNRFLNSEIHQVTKI 478

  Fly   104 GYKLAESVAIL----RYLSAK-----------------------GKIPEHLYPKYFVDQSRVDEF 141
            ..|:||....|    .||.|:                       |..||.|       |..|.|.
  Rat   479 WRKVAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEAAGAEPGDFPELL-------QQLVQEA 536

  Fly   142 LEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSE--------------------AKIETFRMQMER- 185
            |:|:       ......:|.|.|:      ||                    |||:...::... 
  Rat   537 LQWE-------AGEASDSVGLSPV------SEYDDYGFLTVPDYEVEDLKLLAKIQALEVRSHHL 588

  Fly   186 -NLDVVE----EVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWL--KRVR 242
             .|:.||    :.|           .|:.::..:.|::|...|... |...|::..||  :||:
  Rat   589 LALEAVERPLRDRW-----------ATLTELMPSAELKQLLRAGVP-REHRPRVWRWLVHRRVQ 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/128 (19%)
GstA 47..243 CDD:223698 54/268 (20%)
GST_C_Theta 135..259 CDD:198292 27/136 (20%)
Tbc1d2XP_006238118.1 PH_TBC1D2A 44..145 CDD:269966
PH 44..137 CDD:278594
TBC 621..833 CDD:214540 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.