DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Gdap1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:295 Identity:58/295 - (19%)
Similarity:100/295 - (33%) Gaps:87/295 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SRQPTNLRMSAPIR------------YYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTE 85
            :|:....|...|:|            .|:...|..|:.:.::.....:..|:..|:|...|| .|
  Rat     2 ARKQDEARSGVPLRAQGPPAAEVRLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEH-NE 65

  Fly    86 DFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQS-----RVDEFLEWQ 145
            .:...:|....||.:......:.|:..|:.||  :....:...|:...|:.     ||..:.|  
  Rat    66 PWFMRLNSTGEVPVLIHGENIICEATQIIDYL--EQTFLDERTPRLMPDEGSMYYPRVQHYRE-- 126

  Fly   146 HMSLRLTCAMYFRTVWLEPLLT-----------------GRTPSEAK------------------ 175
             :...|....|.....|.|.||                 |.|.||.|                  
  Rat   127 -LLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRGQIGNTESELKKLAEENPDLQEAYIAKQK 190

  Fly   176 --------------IETFRMQMERNLDVV--------EEVWLEG-KDFLTGSSLTVADIFAACEI 217
                          ::....::|:.||.|        ||...|| :.:|.|.|.|:||:..|..:
  Rat   191 RLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPDEGNQPWLCGESFTLADVSLAVTL 255

  Fly   218 EQTRMADYDVRI----KYPKIRAWLKRV--RQSCN 246
            .:.:...:..|.    |.|.:.::.:||  |::.|
  Rat   256 HRLKFLGFARRNWGHGKRPNLESYYERVLKRKTFN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 17/87 (20%)
GstA 47..243 CDD:223698 52/264 (20%)
GST_C_Theta 135..259 CDD:198292 36/181 (20%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 54/271 (20%)
GST_N_GDAP1 26..98 CDD:239350 16/74 (22%)
GST_C_GDAP1 179..289 CDD:198336 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.