DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Clic6

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:178 Identity:38/178 - (21%)
Similarity:64/178 - (35%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALR-------------NGEHLTED--FKKEINRFQRVPCIHDNGY 105
            |:.||:|..|..:.|....|.|:             |...:|.|  .|.::|:.:..        
  Rat   399 SQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEF-------- 455

  Fly   106 KLAESVAILRYLSAKGKIPE------HLYPKY--FVDQSRVDEFLEWQHMSLRLTCAMYFRTVWL 162
             |.|.:...||.....:.||      .::.|:  |:..::.|....::...||....       |
  Rat   456 -LEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANDIYEKNLLRALKK-------L 512

  Fly   163 EPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVAD 210
            :..|....|.|  |:.:.         .|:|.:..:.||.|..||:||
  Rat   513 DSYLNSPLPDE--IDAYS---------TEDVTVSQRKFLDGDELTLAD 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 17/79 (22%)
GstA 47..243 CDD:223698 38/178 (21%)
GST_C_Theta 135..259 CDD:198292 17/76 (22%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 38/178 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.