DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTZ1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:231 Identity:50/231 - (21%)
Similarity:86/231 - (37%) Gaps:76/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVAL--RNGEHLTEDFKKEINRFQRVPCIHDNGYK 106
            ||.|.| ..|..|..:.|...|..:.:|...:.|  ..|:..::|| :.:|..::||.:..:|..
Human     7 PILYSY-FRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF-QALNPMKQVPTLKIDGIT 69

  Fly   107 LAESVAILRYLSAKGKIPEHL--YPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGR 169
            :.:|:||:.||......|..|  .||              :..|:|:          :..|:.| 
Human    70 IHQSLAIIEYLEEMRPTPRLLPQDPK--------------KRASVRM----------ISDLIAG- 109

  Fly   170 TPSEAKIETFRMQMERNLDVVEEV-------WLEGK-----------------DFLTGSSLTVAD 210
                      .:|..:||.|:::|       |.:..                 .:..|..:|:||
Human   110 ----------GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMAD 164

  Fly   211 IFAACEIEQTRMADYDVRIK-----YPKIRAWLKRV 241
            :   |.:.|...|:   |.|     ||.|.:..||:
Human   165 L---CLVPQVANAE---RFKVDLTPYPTISSINKRL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/77 (27%)
GstA 47..243 CDD:223698 48/228 (21%)
GST_C_Theta 135..259 CDD:198292 24/136 (18%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 49/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.