DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Clic2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:258 Identity:53/258 - (20%)
Similarity:85/258 - (32%) Gaps:102/258 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRV 97
            :|:|..|:..||                    .:|.||      |...:.|..||.| |..|   
  Rat    55 ARKPEELKDLAP--------------------GTNPPF------LIYNKELKTDFIK-IEEF--- 89

  Fly    98 PCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFR-TVW 161
                     |.:::|..||        .||.|||              ..|..:.|.::.: :.:
  Rat    90 ---------LEKTLAPPRY--------PHLSPKY--------------KESFDVGCNLFAKFSAY 123

  Fly   162 LEPLLTGRTPSEAKIETFRMQMERNL-----------------DVVEEVWLEGKDFLTGSSLTVA 209
            ::     .|..||. :.|...:.|..                 |..||..|..:.||.|..||:|
  Rat   124 IK-----NTQKEAN-KNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLA 182

  Fly   210 DIFAACEIEQTRMA-----DYDVRIKYPKIRAWLKRVRQSCNPYYDVAHEFVYKISGTGPQAK 267
            |.....::...::|     |:|:..::..:..:|.      |.|  ...||.:    |.|:.|
  Rat   183 DCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLH------NAY--AREEFAH----TCPEDK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 14/75 (19%)
GstA 47..243 CDD:223698 41/218 (19%)
GST_C_Theta 135..259 CDD:198292 26/146 (18%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 16/79 (20%)
GST_N_CLIC 9..99 CDD:239359 17/82 (21%)
O-ClC 12..245 CDD:129941 53/258 (21%)
GST_C_CLIC2 106..244 CDD:198331 30/160 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.