DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gst-35

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_741061.2 Gene:gst-35 / 259481 WormBaseID:WBGene00001783 Length:218 Species:Caenorhabditis elegans


Alignment Length:249 Identity:64/249 - (25%)
Similarity:105/249 - (42%) Gaps:78/249 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YYDL--MSQPSRALF----IIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYK 106
            |:|:  .::|:|.||    :.|..:.||.:|.|..:::.:.|.   .||...|.|.|.:..:|:|
 Worm     8 YFDIRAFAEPARMLFHLGGVPFEDARMPTDDIVPGIQSDQFLA---LKEKTPFGRFPILEFDGFK 69

  Fly   107 LAESVAILRYLSAK----GKIP-EHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLL 166
            :|:|.||.|||:.|    ||.| |..|....|||.:  |::|            .||.| |....
 Worm    70 IAQSAAIQRYLARKFGFAGKTPEEEAYADSIVDQMK--EYIE------------SFRPV-LYAQK 119

  Fly   167 TGRTPSEAKIETFRMQMERNLDVVEEVWLEGKD----------------FLTGSSLTVADIFAAC 215
            :|:...|.|            .:.::|::..|:                ||.|:.||.||:.   
 Worm   120 SGKPEEEVK------------KIHDDVYIPAKNNLIKILNRLLKDNKSGFLVGNGLTYADLV--- 169

  Fly   216 EIEQTRMADYDVRIKYPKIRAWLKRVRQ--SCNPYYDVAHEFVYKISGTGPQAK 267
                  :||:         ...|..:::  |.:|.:.:..:|..||.|. |:.|
 Worm   170 ------VADH---------MFTLSNIKELDSEDPTHKILKDFQEKIYGL-PELK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 27/82 (33%)
GstA 47..243 CDD:223698 56/221 (25%)
GST_C_Theta 135..259 CDD:198292 25/141 (18%)
gst-35NP_741061.2 GST_N_Sigma_like 4..82 CDD:239337 26/76 (34%)
PTZ00057 6..215 CDD:173353 64/249 (26%)
GST_C_Sigma_like 92..200 CDD:198301 29/152 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5602
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.