DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and CLIC4

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:180 Identity:39/180 - (21%)
Similarity:66/180 - (36%) Gaps:54/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALRN----------GEH-----LTEDFKKEINRFQRVPCIHDNGY 105
            |:.||:|..|..:.|....|.|:.          |.|     ...:.|.::|:.:..        
Human    38 SQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEF-------- 94

  Fly   106 KLAESVAILRYLSAKGKIPE------HLYPKY--FVDQSR--VDEFLEWQHMSLRLTCAMYFRTV 160
             |.|.:...:||....|.||      .::.|:  ::..||  .:|.||   ..|..|...     
Human    95 -LEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALE---RGLLKTLQK----- 150

  Fly   161 WLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVAD 210
             |:..|....|.|         ::.|  .:|::....:.||.|:.:|:||
Human   151 -LDEYLNSPLPDE---------IDEN--SMEDIKFSTRKFLDGNEMTLAD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 16/79 (20%)
GstA 47..243 CDD:223698 39/180 (22%)
GST_C_Theta 135..259 CDD:198292 19/78 (24%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101 14/71 (20%)
O-ClC 17..252 CDD:129941 39/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.