DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTT4

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:200 Identity:66/200 - (33%)
Similarity:111/200 - (55%) Gaps:7/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAE 109
            :..|.||:|.|.||::|..:..::.|....|.|..|.|.::.: .:||..:::|.:.|..:.|:|
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGY-IDINPLRKLPSLKDGKFILSE 66

  Fly   110 SVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLE---PLLTGRTP 171
            |.|||.||..|...|.|..|.....::|||||:.|||.:.:|...   :.|||:   |.:||...
Human    67 SAAILYYLCRKYSAPSHWCPPDPHARARVDEFVAWQHTAFQLPMK---KIVWLKLLIPKITGEEV 128

  Fly   172 SEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRA 236
            |..|:|....:::.:|.:.||.:|:.|.|:||:.:::||:.|..|:.|...|:|:|.:...|:..
Human   129 SAEKMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADLVAVVEMMQPMAANYNVFLNSSKLAE 193

  Fly   237 WLKRV 241
            |..:|
Human   194 WRMQV 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 25/75 (33%)
GstA 47..243 CDD:223698 65/197 (33%)
GST_C_Theta 135..259 CDD:198292 36/109 (33%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 25/75 (33%)