DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and SPCC1183.02

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_587885.1 Gene:SPCC1183.02 / 2539015 PomBaseID:SPCC1183.02 Length:220 Species:Schizosaccharomyces pombe


Alignment Length:131 Identity:37/131 - (28%)
Similarity:63/131 - (48%) Gaps:27/131 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QRVPC-IHDNGYKLAESVAILRYLSAKGK--IPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMY 156
            |::|. |..:|::|:|.:||::|...|||  ..|.|.|...|:::   |.|:|.       |.:.
pombe    50 QKLPVFIGADGFELSEVIAIVKYFYEKGKHNDKEGLGPVNEVEEA---EMLKWM-------CFIN 104

  Fly   157 FRTV-------WLEPLLTGRTPSEAKIETFRMQMERNLD---VVEEVWLEGKDFLTGSSLTVADI 211
            |..|       |: .:..|..|.|.|  .|:....|.:|   :..|: ::.:.:|.|...|:||:
pombe   105 FDIVTPQNVRPWV-GMFRGNIPYEEK--PFKESATRAIDSLKIPNEL-VKDRTYLVGDRFTLADL 165

  Fly   212 F 212
            |
pombe   166 F 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 9/26 (35%)
GstA 47..243 CDD:223698 37/131 (28%)
GST_C_Theta 135..259 CDD:198292 21/88 (24%)
SPCC1183.02NP_587885.1 GST_N_EF1Bgamma 4..76 CDD:239342 9/25 (36%)
GstA 28..198 CDD:223698 37/131 (28%)
GST_C_EF1Bgamma_like 92..217 CDD:198290 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2071
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.