DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gst1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:187 Identity:45/187 - (24%)
Similarity:86/187 - (45%) Gaps:41/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 RNGEHLTEDFKKEINRFQRVPCI---HDNGYKLAESVAILRYLSAKGKIPEHL-----YPKYFVD 134
            ::.|||.      :|...|||.:   |:|.|.:.||.|||.||:.|......:     :|:|:  
pombe    42 KSPEHLA------LNPNGRVPTLIDHHNNDYTIWESDAILIYLADKYDTERKISLPRDHPEYY-- 98

  Fly   135 QSRVDEFLEWQHMSLRLTC--AMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEG 197
              :|.::|.:|.....:..  |.:|.....|.:::.       |..:|.:::|.|.|:|:: |:.
pombe    99 --KVIQYLFFQASGQGIIWGQAGWFSVYHQELVISA-------ITRYRNEIKRVLGVLEDI-LKD 153

  Fly   198 KDFLTGSSLTVAD------------IFAACEIE-QTRMADYDVRIKYPKIRAWLKRV 241
            :|:|..:..|:||            |||..:.. :..:...|...::|:..:|.:|:
pombe   154 RDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVPQLDFEKEFPRTYSWHQRL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 17/45 (38%)
GstA 47..243 CDD:223698 45/187 (24%)
GST_C_Theta 135..259 CDD:198292 25/122 (20%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 18/47 (38%)
GstA 5..218 CDD:223698 45/187 (24%)
GST_C_Ure2p 96..219 CDD:198326 26/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.