DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstE9

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:220 Identity:56/220 - (25%)
Similarity:98/220 - (44%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYL 117
            |.|.||..:......:.:|..:|.|..|||.|::|..: |....||.:.|:|..:.||.||..||
  Fly    12 SPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLK-NPQHTVPVLEDDGKFIWESHAICAYL 75

  Fly   118 SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTC------AMYFRTVWLEPLLTGRTPSEAKI 176
            ..:....:.||||.:..::.||:.|.::...|...|      .::::.:...|    |:..:|..
  Fly    76 VRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVP----RSQIDAIY 136

  Fly   177 ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQ-TRMADYDVRIKYPKIRAWLKR 240
            |.:        |.: |.::..:.:|.|..:|:||......:.. ..:|..|.: :|||:..||.|
  Fly   137 EAY--------DFL-EAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAK-RYPKLNGWLDR 191

  Fly   241 VRQSCNPYYDVAHEFVYKISGTGPQ 265
            :  :..|.|.       .::|.|.|
  Fly   192 M--AAQPNYQ-------SLNGNGAQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 23/67 (34%)
GstA 47..243 CDD:223698 51/196 (26%)
GST_C_Theta 135..259 CDD:198292 26/130 (20%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 53/212 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 22/64 (34%)
GST_C_Delta_Epsilon 92..209 CDD:198287 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460075
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.