DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and AIMP3

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:103 Identity:18/103 - (17%)
Similarity:39/103 - (37%) Gaps:34/103 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SEAKIETFR-MQMERNLDVVEEVWLE----------------------------GKDFLTGSSLT 207
            ||:|.||.: .:..|.::.....|:|                            .|.:|.|..:|
  Fly    51 SESKSETAQNSRASREVEAQVYQWIEFSVLYVAPGSKDKYVSKQLLADFNKLFASKSYLVGHFIT 115

  Fly   208 VADI---FAACEIEQTRMADYDVRIKYPKIRAWLKRVR 242
            :||:   :|..::.:: ::..|..: |..:..|...::
  Fly   116 LADLAVYYAIYDLVKS-LSPVDKEV-YLNLSRWFDHLQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348
GstA 47..243 CDD:223698 18/103 (17%)
GST_C_Theta 135..259 CDD:198292 18/103 (17%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 13/89 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.