DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d8b

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001074968.1 Gene:Tbc1d8b / 245638 MGIID:1918101 Length:1114 Species:Mus musculus


Alignment Length:235 Identity:46/235 - (19%)
Similarity:82/235 - (34%) Gaps:81/235 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LASLLGLSNDED---QLQVAFDEVLKRRVPSRQPTNLRMSAPI---------------------R 46
            |..||...:|.:   .|...||.|:.:..|  .|:|::..:.|                     :
Mouse   689 LDKLLTCKDDAEAVTALNRFFDNVINKDSP--LPSNVQQGSNISNEKSDHTKVDITDLIKESNEK 751

  Fly    47 Y----YYDLMSQPSR-ALFIIFRLS--------NMPFEDCVVALRNGEHLTEDFKKEINRFQRVP 98
            |    |.|:.|...| .|::|..|.        .:..:|..::|:..:.|...||||:       
Mouse   752 YGSIRYEDIHSMRCRNRLYVIQTLEETTKQNVLRVVSQDVKMSLQELDELYVIFKKEL------- 809

  Fly    99 CIHDNGYKLAESVAILRYLSAKGKIPEHLYPKY-FVDQSRVDEFLEWQHMSLRLTCAMYFRTVW- 161
                       .::...|||..|.  :|..|.. :::|.::|              ...||.:: 
Mouse   810 -----------FISCYWYLSCPGL--KHHDPSLPYLEQYQID--------------CQQFRVLYH 847

  Fly   162 -LEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDF 200
             |.|...........:.|||: ::.|.|.:    :..|:|
Mouse   848 LLSPWAHSANRDSLALWTFRL-LDENSDCL----INFKEF 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 19/109 (17%)
GstA 47..243 CDD:223698 34/170 (20%)
GST_C_Theta 135..259 CDD:198292 13/68 (19%)
Tbc1d8bNP_001074968.1 PH-GRAM1_TBC1D8B 156..254 CDD:275419
PH-GRAM2_TBC1D8B 296..388 CDD:270159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..420
TBC 485..693 CDD:214540 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 938..957
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1032..1061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.