DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and RABGAP1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_036329.3 Gene:RABGAP1 / 23637 HGNCID:17155 Length:1069 Species:Homo sapiens


Alignment Length:288 Identity:57/288 - (19%)
Similarity:98/288 - (34%) Gaps:110/288 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SFLASLLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNM 68
            ||||::|.|...|:|   ||..::|                |.:.|.|     |.||      ..
Human   652 SFLAAVLLLHMPEEQ---AFSVLVK----------------IMFDYGL-----RELF------KQ 686

  Fly    69 PFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLA------ESVAILRYLSAKGKIPEHL 127
            .|||........|.|.:::         :|.::::...::      .|...|...:||       
Human   687 NFEDLHCKFYQLERLMQEY---------IPDLYNHFLDISLEAHMYASQWFLTLFTAK------- 735

  Fly   128 YPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQM------ERN 186
            :|.|.|  ..:.:.|..:.:|:....|:.......:.||.  |..|..::.||:|:      |.|
Human   736 FPLYMV--FHIIDLLLCEGISVIFNVALGLLKTSKDDLLL--TDFEGALKFFRVQLPKRYRSEEN 796

  Fly   187 LDVVEEVWLEGKDFLTGSSLTVADIFAAC--EIEQTRMADYDVRIKYPKIRAWLKRVRQSCNPYY 249
            ...:.|:                    ||  :|.|.::..|:.  :|..:|   ::..|..:|..
Human   797 AKKLMEL--------------------ACNMKISQKKLKKYEK--EYHTMR---EQQAQQEDPIE 836

  Fly   250 ---------------------DVAHEFV 256
                                 |:|||.|
Human   837 RFERENRRLQEANMRLEQENDDLAHELV 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 15/81 (19%)
GstA 47..243 CDD:223698 38/209 (18%)
GST_C_Theta 135..259 CDD:198292 27/151 (18%)
RABGAP1NP_036329.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
PTB_Rab6GAP 145..273 CDD:269922
DUF3694 307..437 CDD:403614
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..527
TBC 563..772 CDD:214540 33/167 (20%)
Smc <823..>1047 CDD:224117 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.