DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and TBC1D2B

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001374071.1 Gene:TBC1D2B / 23102 HGNCID:29183 Length:974 Species:Homo sapiens


Alignment Length:176 Identity:34/176 - (19%)
Similarity:61/176 - (34%) Gaps:50/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RYYYDLMSQPSRAL------------FIIFRLSNMPFEDCVVA----------LRNGEHLTEDFK 88
            |.:.||||:....|            .|.|....:.|.|.||:          |..|..:...|.
Human   800 RVFRDLMSEKLPRLHGHFEQYKVDYTLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFA 864

  Fly    89 KEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTC 153
            ..:.:::....:     ||.:|::|.:||            :||....          :..|...
Human   865 LALFKYKEEEIL-----KLQDSMSIFKYL------------RYFTRTI----------LDARKLI 902

  Fly   154 AMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKD 199
            ::.|..:...||...|......:|..|::: ..|:.:.|.:|..:|
Human   903 SISFGDLNPFPLRQIRNRRAYHLEKVRLEL-TELEAIREDFLRERD 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/96 (22%)
GstA 47..243 CDD:223698 33/175 (19%)
GST_C_Theta 135..259 CDD:198292 11/65 (17%)
TBC1D2BNP_001374071.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PH_TBC1D2A 36..144 CDD:269966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..348
Smc <338..552 CDD:224117
RabGAP-TBC 665..876 CDD:366170 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.