DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:297 Identity:51/297 - (17%)
Similarity:95/297 - (31%) Gaps:101/297 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSRQPTNLRMSAPIRY-------YYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKK 89
            |...|.....|:|..:       |:...|..|:.:.::.....:..|:..|:|...|| .|.:..
Mouse    27 PVETPDAPEASSPAHWPKESLVLYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEH-KEPWFM 90

  Fly    90 EINRFQRVPCIHDNGYKLAESVAILRY------------LSAKGKIPEH---------------- 126
            .:|..:.||.|......:::...|:.|            |..:...|:|                
Mouse    91 RLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMD 155

  Fly   127 ----------------LYPKYFVDQSRVDEFLEWQHMSLRLTCAMYF----RTVWLEPLLTGRTP 171
                            :.|||...:.|       :|::...|..|..    .....||.|:.:..
Mouse   156 AYTHGCILHPELTTDSMIPKYATAEIR-------RHLANATTDLMKLDHEEEPQLSEPYLSKQKK 213

  Fly   172 SEAKI---------ETFRMQMERNLDVVE---------------EVWLEGKDFLTGSSLTVADIF 212
            ..|||         :....::...||.:|               |:|      |.|.:.|:||:.
Mouse   214 LMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQTCELW------LCGCAFTLADVL 272

  Fly   213 AACEIEQTRMADYDVRIKY------PKIRAWLKRVRQ 243
            ....:.  |:....:..||      |.::::.:||::
Mouse   273 LGATLH--RLKFLGLSKKYWEDGSRPNLQSFFERVQR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 16/94 (17%)
GstA 47..243 CDD:223698 47/280 (17%)
GST_C_Theta 135..259 CDD:198292 26/143 (18%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 47/277 (17%)
GST_N_GDAP1 47..119 CDD:239350 15/72 (21%)
GST_C_family 201..311 CDD:295467 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.