DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstT3 and Mars1

DIOPT Version :9

Sequence 1:	NP_001162808.1	Gene:	GstT3 / 33047	FlyBaseID:	FBgn0031117	Length:	268	Species:	Drosophila melanogaster
Sequence 2:	NP_001165053.1	Gene:	Mars1 / 216443	MGIID:	1345633	Length:	910	Species:	Mus musculus

Alignment Length:	164	Identity:	32/164 - (19%)
Similarity:	59/164 - (35%)	Gaps:	64/164 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly    65 LSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIH-DNGYKLAESVAILRYLSAKGKIPEHLY 128
            :|.:..|:|||..     ||.         .:||.:. |:|..|..:.||.||
Mouse    30 ISTVGPEECVVPF-----LTR---------PKVPVLQLDSGNYLFSASAICRY------------ 68

  Fly   129 PKYFV-----DQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLD 188
              :|:     .....:::|||:             ...|:|:|:      |.:....:|.::..|
Mouse    69 --FFLLCGWEQDDLTNQWLEWE-------------ATELQPVLS------AALHCLVVQGKKGED 112

  Fly   189 VV-----------EEVWLEGKDFLTGSSLTVADI 211
            ::           ..:..:...||.|.:.::|||
Mouse   113 ILGPLRRVLTHIDHSLSRQNCPFLAGDTESLADI 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstT3	NP_001162808.1	GST_N_Theta	45..121	CDD:239348	16/56 (29%)
		GstA	47..243	CDD:223698	32/164 (20%)
		GST_C_Theta	135..259	CDD:198292	15/88 (17%)
Mars1	NP_001165053.1	Thioredoxin_like	1..68	CDD:294274	14/51 (27%)
		GstA	<47..189	CDD:223698	25/133 (19%)
		GST_C_MetRS_N	77..179	CDD:198340	15/89 (17%)
		PRK12268	266..821	CDD:237029
		MetRS_core	267..635	CDD:173907
		'HIGH' region	275..285
		'KMSKS' region	595..599
		Anticodon_Ia_Met	644..773	CDD:153411
		MetRS_RNA	855..899	CDD:238475
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0625
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900