DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Clic6

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:178 Identity:38/178 - (21%)
Similarity:63/178 - (35%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALR-------------NGEHLTED--FKKEINRFQRVPCIHDNGY 105
            |:.||:|..|..:.|....|.|:             |...:|.|  .|.::|:.:..        
Mouse   382 SQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEF-------- 438

  Fly   106 KLAESVAILRYLSAKGKIPE------HLYPKY--FVDQSRVDEFLEWQHMSLRLTCAMYFRTVWL 162
             |.|.:...||.....:.||      .::.|:  |:..::.|....::...||....       |
Mouse   439 -LEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLLRALKK-------L 495

  Fly   163 EPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVAD 210
            :..|....|.|.           :.|..|:|.:..:.||.|..||:||
Mouse   496 DSYLNSPLPDEI-----------DADSSEDVTVSQRKFLDGDELTLAD 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 17/79 (22%)
GstA 47..243 CDD:223698 38/178 (21%)
GST_C_Theta 135..259 CDD:198292 17/76 (22%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360
PHA02664 <69..167 CDD:177447
GST_N_CLIC 360..448 CDD:239359 15/74 (20%)
O-ClC 363..596 CDD:129941 38/178 (21%)
GST_C_CLIC6 455..594 CDD:198334 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.