DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and eef1g

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:148 Identity:36/148 - (24%)
Similarity:65/148 - (43%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RVPCIH-DNGYKLAESVAILRYLS---AKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMY 156
            :||... |:|:.|.||.||..|||   .:|..|:           ...:.|:|  :|...:..:.
Zfish    57 KVPAYQGDDGFCLFESNAIAHYLSNDVLRGSTPQ-----------ASAQVLQW--VSFADSEVIP 108

  Fly   157 FRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEI--EQ 219
            ..:.|:.|.|.....::...|..:.:::|.|.|:.: .|..:.||.|..:::|||...|.:  ..
Zfish   109 PASAWVFPTLGIMQFNKQATEQAKEEVKRVLAVLNQ-HLNTRTFLVGERISLADITVVCSLLWLY 172

  Fly   220 TRMADYDVRIKYPKIRAW 237
            .::.:...|..||.:..|
Zfish   173 KQVLELAFRQPYPNVTRW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 12/28 (43%)
GstA 47..243 CDD:223698 36/148 (24%)
GST_C_Theta 135..259 CDD:198292 22/105 (21%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 12/24 (50%)
maiA 5..201 CDD:273527 36/148 (24%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 22/103 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.