DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gst-21

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:185 Identity:47/185 - (25%)
Similarity:83/185 - (44%) Gaps:39/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YYD--LMSQPSRALFIIFRLSNMPFEDCVV-------ALRNGEHLTEDFKKEINRFQRVPCIHDN 103
            |:|  .:::|:|   ::|.|..:||||..:       .:.|.|  ..|.||:. .|.:.|.:..:
 Worm    20 YFDGRGLAEPAR---MLFHLGGVPFEDSRIPVDMKTGLIMNPE--LADVKKKA-PFGKYPVLKID 78

  Fly   104 GYKLAESVAILRYLSAK----GKIPEHLYPKYFVDQSRVDEFL-EWQHMSLRLTCAMYFRTVWLE 163
            ..::|:|.||.|||:.:    ||.|        :::::.|.:: :.|..:......||       
 Worm    79 DIEIAQSAAINRYLARQFGFAGKNP--------IEEAQADSYIDQCQEYNTSFRACMY------- 128

  Fly   164 PLLTGRTPSEA-KI--ETFRMQMERNLDVVEEVWLEGKD-FLTGSSLTVADIFAA 214
            ..|.|:...|. ||  |.:.....:..::..::....|. ||.|.|||.||:..|
 Worm   129 ATLQGKPEEEVQKIREEVYIPAQNKFYEIFSDILNRNKSGFLVGDSLTWADLVIA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/85 (28%)
GstA 47..243 CDD:223698 47/185 (25%)
GST_C_Theta 135..259 CDD:198292 20/85 (24%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 24/79 (30%)
PTZ00057 18..231 CDD:173353 47/185 (25%)
GST_C_Sigma_like 104..213 CDD:198301 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.