DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gst-29

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_497118.1 Gene:gst-29 / 190225 WormBaseID:WBGene00001777 Length:209 Species:Caenorhabditis elegans


Alignment Length:234 Identity:56/234 - (23%)
Similarity:104/234 - (44%) Gaps:56/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YYDL--MSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAES 110
            |:|:  .::|:|   |:|.|:.:||:|  ....:|:...|..|.: ..|.:||.::.:|:::.:|
 Worm     8 YFDVRAYAEPAR---ILFHLAGVPFDD--HRFPHGDGTWEKLKDK-TPFGQVPVLYVDGFEIPQS 66

  Fly   111 VAILRYLSAK----GKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTP 171
            .||:|||:.|    ||.||.   :.:.| :.||:|.::  |||       ||...|     .:..
 Worm    67 AAIIRYLANKFGYAGKTPEE---QAWAD-AIVDQFKDF--MSL-------FREFKL-----AQKA 113

  Fly   172 SEAKIETFRMQMERNLDVVEEVWLEGKD----------------FLTGSSLTVADIFAACEIEQT 220
            .::.:|..:        |..||.:..:|                ||.|..||.|||.....:...
 Worm   114 GKSDVEIAK--------VASEVAIPARDSYFEIITNLLEKSKSGFLVGDGLTFADIVVVESLTNL 170

  Fly   221 RMADYDVRIKYPKIRAWLKRVR--QSCNPYYDVAHEFVY 257
            ....:....::||:.|..:::.  .:...:.|:..:.:|
 Worm   171 EKVHFFDASEHPKLAALREKIYAIPAIKSWVDIRPDTIY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/78 (31%)
GstA 47..243 CDD:223698 54/218 (25%)
GST_C_Theta 135..259 CDD:198292 27/141 (19%)
gst-29NP_497118.1 GST_N_Sigma_like 4..74 CDD:239337 22/71 (31%)
PTZ00057 6..209 CDD:173353 55/232 (24%)
GST_C_Sigma_like 85..191 CDD:198301 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.