DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gst-27

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:218 Identity:52/218 - (23%)
Similarity:99/218 - (45%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YYDL--MSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAES 110
            |:::  ..:|:|   |:|.|:::||||..:.:.:|   |.:..|....|.:.|.:..:|:::.:|
 Worm     8 YFNVRGYGEPAR---ILFHLADVPFEDFRMTIGDG---TWENLKAKTPFGQAPVLSVDGFEIPQS 66

  Fly   111 VAILRYLSAK----GKIP-EHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRT 170
            .||.|||:.:    ||.| |..:....|||.:  :|:    :|::...         :....|::
 Worm    67 AAINRYLAKQFGYAGKTPEEQAWTDAIVDQYK--DFM----VSIKEVG---------KASAAGKS 116

  Fly   171 PSE-AKIETFRMQMERN--LDVVEEVWLEGKD-FLTGSSLTVADI--------------FAACEI 217
            ..| .||....:...|:  ..::.::..:.|. ||.|..||:|||              |.|.  
 Worm   117 AEEVGKIIQSDLVPARDAFFVIINKILEKSKSGFLVGDGLTIADIVIVECITTLDKHQLFTAS-- 179

  Fly   218 EQTRMADYDVRI-KYPKIRAWLK 239
            ||.::.....:: ..|.|:.|::
 Worm   180 EQPKLVALREKVYAIPAIKKWVE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/78 (28%)
GstA 47..243 CDD:223698 52/218 (24%)
GST_C_Theta 135..259 CDD:198292 24/124 (19%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 22/72 (31%)
PTZ00057 6..208 CDD:173353 52/218 (24%)
GST_C_Sigma_like 85..191 CDD:198301 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.