DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and exl-1

DIOPT Version :10

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:132 Identity:26/132 - (19%)
Similarity:49/132 - (37%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFV--DQSRVDEFLE 143
            |:.|.|..::..||.:.....|..:. .|.:.:.:|||.:       ..|:.:  |.:.:|..:.
 Worm   102 ENATCDLFRQFARFVKDVEHRDTAFN-TELLRLDKYLSEQ-------ETKFLISDDVTHIDCLVL 158

  Fly   144 WQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAK-----------IETFRMQMERNLDVVEEVWLEG 197
            .:..|:|:...|         |.....|::..           .|.||:....:.::|.. |.|.
 Worm   159 TRLHSIRVAAKM---------LKNYEIPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLH-WTEL 213

  Fly   198 KD 199
            ||
 Worm   214 KD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 10/39 (26%)
GST_C_Theta 135..259 CDD:198292 14/76 (18%)
exl-1NP_497000.1 GST_C_family 98..210 CDD:470672 22/125 (18%)

Return to query results.
Submit another query.