DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and exl-1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:132 Identity:26/132 - (19%)
Similarity:49/132 - (37%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFV--DQSRVDEFLE 143
            |:.|.|..::..||.:.....|..:. .|.:.:.:|||.:       ..|:.:  |.:.:|..:.
 Worm   102 ENATCDLFRQFARFVKDVEHRDTAFN-TELLRLDKYLSEQ-------ETKFLISDDVTHIDCLVL 158

  Fly   144 WQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAK-----------IETFRMQMERNLDVVEEVWLEG 197
            .:..|:|:...|         |.....|::..           .|.||:....:.::|.. |.|.
 Worm   159 TRLHSIRVAAKM---------LKNYEIPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLH-WTEL 213

  Fly   198 KD 199
            ||
 Worm   214 KD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 10/39 (26%)
GstA 47..243 CDD:223698 26/132 (20%)
GST_C_Theta 135..259 CDD:198292 14/76 (18%)
exl-1NP_497000.1 O-ClC 2..213 CDD:129941 23/128 (18%)
GST_C_family 98..210 CDD:295467 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.