DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and TBC1D21

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006720472.1 Gene:TBC1D21 / 161514 HGNCID:28536 Length:399 Species:Homo sapiens


Alignment Length:266 Identity:49/266 - (18%)
Similarity:89/266 - (33%) Gaps:85/266 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 CVVALRNGEH----------LTEDFKKEINRFQR--VPCIHDNGYK----LAESVAIL------R 115
            ||..|..|.|          ||..|..:.::.:|  |..:....||    :.|.:..|      .
Human    50 CVNILERGLHPFVRTEAWKFLTGYFSWQSSQDERLTVDSMRRKNYKALCQMYEKIQPLLENLHRN 114

  Fly   116 YLSAKGKIP---EHLYPK-----YFVDQSRVDEFL----------EWQH------MSLRLTCAMY 156
            :...:..|.   :.:|.|     ..:|:.|:::.|          |:|.      |..:|.....
Human   115 FTETRNNIARDIQKIYDKDPLGNVLIDKKRLEKILLLSYVCNTQAEYQQGFHEMMMLFQLMVEHD 179

  Fly   157 FRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEV----------WLEGKDFLTGSSL----- 206
            ..|.||......:|.....|   .:.:.:|||::..:          .|:||......||     
Human   180 HETFWLFQFFLQKTEHSCVI---NIGVAKNLDMLSTLITFLDPVFAEHLKGKGAGAVQSLFPWFC 241

  Fly   207 --------TVADIFAACEIEQT--RMADYDVRIKYPKIRAWLKRVRQ----------SCNPYYDV 251
                    :..|::...|:..|  ...::.|.:.|..::...::|.|          :||...|:
Human   242 FCFQRAFKSFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQVLQESMGGDDILLACNNLIDL 306

  Fly   252 -AHEFV 256
             |.|.:
Human   307 DADELI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 14/69 (20%)
GstA 47..243 CDD:223698 43/240 (18%)
GST_C_Theta 135..259 CDD:198292 31/174 (18%)
TBC1D21XP_006720472.1 TBC 62..287 CDD:214540 37/227 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.