DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTO2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:222 Identity:48/222 - (21%)
Similarity:81/222 - (36%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQR 96
            |...|..|     ||.|.......|....::.:..::..|...:.|||    ..::....:.|..
Human    16 PGPVPEGL-----IRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRN----KPEWYYTKHPFGH 71

  Fly    97 VPCIHDNGYKLA-ESVAILRYLSAKGKIPEHLYP--KYF----VDQSRVDEFLEWQHMSLRLTCA 154
            :|.:..:..:|. |||....||       :..||  |.|    .:::|       |.|.|.|.|.
Human    72 IPVLETSQCQLIYESVIACEYL-------DDAYPGRKLFPYDPYERAR-------QKMLLELFCK 122

  Fly   155 M-YFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIE 218
            : :.....|..|..||..:..| ...|.:.. ||:.:.|  .:...|..|:.:::.|.......|
Human   123 VPHLTKECLVALRCGRECTNLK-AALRQEFS-NLEEILE--YQNTTFFGGTCISMIDYLLWPWFE 183

  Fly   219 QTRMADY---DVRIKYPKIRAWLKRVR 242
              |:..|   |.....|.:|.|:..::
Human   184 --RLDVYGILDCVSHTPALRLWISAMK 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 16/76 (21%)
GstA 47..243 CDD:223698 43/207 (21%)
GST_C_Theta 135..259 CDD:198292 25/112 (22%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 19/93 (20%)