DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and TBC1D8

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005263919.1 Gene:TBC1D8 / 11138 HGNCID:17791 Length:1162 Species:Homo sapiens


Alignment Length:210 Identity:41/210 - (19%)
Similarity:76/210 - (36%) Gaps:48/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSA--- 119
            |.|:..::..:..|:....|...|...|.|::.:.:|:.       .:...|:..::.|.|.   
Human   133 ASFVKGKVKALIAEETSSRLAEQEEEPEKFREALVKFEA-------RFNFPEAEKLVTYYSCCCW 190

  Fly   120 KGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYF------RTV--WLEPLLTGRTPSEAKI 176
            ||::|..                .|.::|:...|...|      :.|  |::.....||.:....
Human   191 KGRVPRQ----------------GWLYLSINHLCFYSFFLGKELKLVVPWVDIQKLERTSNVFLT 239

  Fly   177 ETFRM---------QMERNLDVVEEVWLEGKDFLTGSSLTVADIF----AACEIEQTRMADYDVR 228
            :|.|:         .|..|||.|.:|..:..| :|...|...::|    ...|..|....|.:.|
Human   240 DTIRITTQNKERDFSMFLNLDEVFKVMEQLAD-VTLRRLLDNEVFDLDPDLQEPSQITKRDLEAR 303

  Fly   229 IKYPKIRAWLKRVRQ 243
            .:....||:.:..|:
Human   304 AQNEFFRAFFRLPRK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 11/65 (17%)
GstA 47..243 CDD:223698 40/208 (19%)
GST_C_Theta 135..259 CDD:198292 27/130 (21%)
TBC1D8XP_005263919.1 PH-GRAM1_TBC1D8 178..276 CDD:270156 23/114 (20%)
PH-GRAM2_TBC1D8 318..413 CDD:270160 0/1 (0%)
TBC 527..733 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.