DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and TBC1D3E

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001278395.1 Gene:TBC1D3E / 102723859 HGNCID:27071 Length:549 Species:Homo sapiens


Alignment Length:92 Identity:21/92 - (22%)
Similarity:37/92 - (40%) Gaps:12/92 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EDCVVALRNGEH--LTED-----FKKEINRFQRVPCIHDN---GYKLAESVAILRYLSAKGKIPE 125
            ||.::....|..  |.||     |:...|....:..:|:.   .....|:..|.|.:|.|.|..:
Human    16 EDIIMKYEKGHRAGLPEDKGPKPFRSYNNNVDHLGIVHETELPPLTAREAKQIRREISRKSKWVD 80

  Fly   126 HL--YPKYFVDQSRVDEFLEWQHMSLR 150
            .|  :.||...:..:|:..:...|::|
Human    81 MLGDWEKYKSSRKLIDQAYKGMPMNIR 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 13/59 (22%)
GstA 47..243 CDD:223698 21/92 (23%)
GST_C_Theta 135..259 CDD:198292 3/16 (19%)
TBC1D3ENP_001278395.1 TBC 99..312 CDD:214540 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.