DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d14

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001106833.1 Gene:Tbc1d14 / 100855 MGIID:1098708 Length:714 Species:Mus musculus


Alignment Length:269 Identity:55/269 - (20%)
Similarity:99/269 - (36%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DEDQLQVAFDEVLKRRVPSRQPT---NLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVA 76
            |..:.|..:::...|  |||.|:   |:|.:      .|.....:.||.:..|.:|:|.:....|
Mouse   296 DSKKTQKEYEDKAGR--PSRPPSPKQNVRKN------LDFEPLSTTALILEDRPANLPAKPAEEA 352

  Fly    77 LRNGEHLTEDF----KKEINRFQRVPCIHDNGYKLAESV--AILRYLSAKGKIPEHLYPKYFVDQ 135
            .::.:...|..    |:|:...||.....:...|:.||:  |:|.:       ...:.|      
Mouse   353 QKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTW-------NNEILP------ 404

  Fly   136 SRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPS-EAKIETFRMQMERNL-----DV----V 190
                   .|:.|    .|:...|.:|.:    |..|| ..|:.:..:..|.|:     |:    .
Mouse   405 -------NWETM----WCSKKVRDLWWQ----GIPPSVRGKVWSLAIGNELNITHELFDICLARA 454

  Fly   191 EEVWLEGKDFLTGSS--------LTVADIFAACEIEQTRMADYDVRIKYPKIRAWLKRVRQSCNP 247
            :|.|   :...||.|        .:.||..|:.|     :...|:...:|.:     .:.|...|
Mouse   455 KERW---RSLSTGGSEVENEDAGFSAADREASLE-----LIKLDISRTFPNL-----CIFQQGGP 506

  Fly   248 YYDVAHEFV 256
            |:|:.|..:
Mouse   507 YHDMLHSIL 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 17/81 (21%)
GstA 47..243 CDD:223698 41/219 (19%)
GST_C_Theta 135..259 CDD:198292 28/140 (20%)
Tbc1d14NP_001106833.1 ARGLU <350..>392 CDD:373772 9/41 (22%)
TBC 419..651 CDD:214540 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.