DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and tbc1d12b

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005169505.1 Gene:tbc1d12b / 100332088 ZFINID:ZDB-GENE-121214-108 Length:771 Species:Danio rerio


Alignment Length:210 Identity:44/210 - (20%)
Similarity:81/210 - (38%) Gaps:48/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ALFIIFRLSNMPFEDCVVALRN----GEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLS 118
            ||.:..|.:|:|.:....|.|:    .|.:.|..|:|:...|:........:|..||:|....:.
Zfish   393 ALILEDRPANLPAKSEEEAQRHRQEYDEMVAEAKKRELKEAQKKKKQMKERFKQEESIANAMVVW 457

  Fly   119 AKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPS-EAKIETFRMQ 182
            ....:|                  .|:  |:|.|..:  |.:|.:    |..|: ..|:.:..:.
Zfish   458 NTEILP------------------NWE--SMRGTRRV--RDLWWQ----GLPPNVRGKVWSLAVG 496

  Fly   183 MERNL--DVVE-------EVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWL 238
            .|.|:  |:.|       |.|...::  |||.:. :|:.:|.......:...|:...:|.:    
Zfish   497 NELNITSDLYEIFLSRAKERWKSFRE--TGSEIE-SDVDSADRESSLDLIKLDISRTFPSL---- 554

  Fly   239 KRVRQSCNPYYDVAH 253
             .:.|...||:|:.|
Zfish   555 -FIFQKGGPYHDLLH 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 16/66 (24%)
GstA 47..243 CDD:223698 39/198 (20%)
GST_C_Theta 135..259 CDD:198292 27/129 (21%)
tbc1d12bXP_005169505.1 TPX2 407..>451 CDD:284337 10/43 (23%)
TBC 478..708 CDD:214540 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.