DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gstz1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:227 Identity:51/227 - (22%)
Similarity:90/227 - (39%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVAL--RNGEHLTEDFKKEINRFQRVPCIHDN 103
            :..|:.|.| ..|..|..:.|......:.::..|:.|  ..|..|:.:: |::|..|:||.:..:
 Frog     4 LGKPLLYGY-FRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEY-KQVNPMQQVPALCID 66

  Fly   104 GYKLAESVAILRYLSAKGKIPEHL--YPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLL 166
            |..|::|:||:.||......|..|  .||.......:.:.:......|:..|.:           
 Frog    67 GVTLSQSLAIIEYLEETRPNPPLLPRDPKKRAQVRMISDQIASGIQPLQNLCVL----------- 120

  Fly   167 TGRTPSEAKIETFRMQMERNLDVVEEV--WLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRI 229
              :...|.|:|..:..:.|....:|::  ...|: :..|..:|:||:   |.:.|...|   ||.
 Frog   121 --QKIGETKLEWAKHFITRGFQALEKLLQTTAGR-YCVGDEVTIADL---CLVPQVANA---VRF 176

  Fly   230 K-----YPKIRAWLKRVRQ---------SCNP 247
            |     ||.|....:.:.|         ||.|
 Frog   177 KVDLAPYPTIVGINESLLQLEAFQVSHPSCQP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/77 (27%)
GstA 47..243 CDD:223698 46/206 (22%)
GST_C_Theta 135..259 CDD:198292 25/129 (19%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 50/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.