Sequence 1: | NP_728346.2 | Gene: | CG1695 / 33046 | FlyBaseID: | FBgn0031116 | Length: | 1192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006717605.1 | Gene: | USP6NL / 9712 | HGNCID: | 16858 | Length: | 856 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 45/198 - (22%) |
---|---|---|---|
Similarity: | 88/198 - (44%) | Gaps: | 24/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 979 NLHRIEKDVQRCDRNYWYFANE---NLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDES 1040
Fly 1041 LSYSCFCKLMER--------MIENFPSGGAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFC 1097
Fly 1098 YRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVL-FLALALLETYRDIILSNSMDFTDVIKF 1161
Fly 1162 FNE 1164 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1695 | NP_728346.2 | RUN | 63..237 | CDD:280855 | |
PH_RUTBC | 310..485 | CDD:275431 | |||
SRP68-RBD | <648..>713 | CDD:304552 | |||
TBC | 947..1124 | CDD:214540 | 35/155 (23%) | ||
USP6NL | XP_006717605.1 | TBC | 125..340 | CDD:214540 | 40/181 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |